Bacterial taxon 909946
Locus STM474_3076
Protein WP_000490481.1
aminopeptidase
Salmonella enterica Serovar Typhimurium ST4 74
Length 348 aa, Gene iap, UniProt E8X8L5
>WP_000490481.1|Salmonella enterica Serovar Typhimurium ST4 74|aminopeptidase
MFSATRRFAVILALGVGFILPAQAASPGPGEIANTQARHIATFFPGRMTGSPAEMLSADYLRQQFTQMGYQSDIRTFNSRFIYTTKDNRKNWHNVTGSTVIAAHEGRVPQQIIIMAHLDTYAPQSDADVDANLGGLTLQGMDDNAAGLGVMLELAARLKDIPTHYGIRFIATSGEEEGKLGAENLLKRMSDAEKKNTLLVINLDNLIVGDKLYFNSGKNTPEAVRTLTRDRALAIARRYGIAANTNPGRNPSYPKGTGCCNDAEVFDKAGISVLSVEATNWNLGKKDGYQQRVKNASFPNGNSWHDVRLDNQQHIDKALPGRIERRSRDVVRIMLPLVKELAKAEKTS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,099,047 | 2.39 | 0.00065 | ○○○○○ 1.42 | 1.41761389892347 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,099,115 | 0.33 | 0.96 | ○○○○○ 0.35 | 0.345952823712501 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,099,047 | 0.5 | 0.7 | ○○○○○ 0.44 | 0.437563559331199 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,099,047 | 0.81 | 0.95 | ○○○○○ 0.6 | 0.598007289631615 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,099,115 | 1.51 | 0.36 | ○○○○○ 0.96 | 0.961883185171512 | 23637626 |
Retrieved 5 of 5 entries in 0.8 ms
(Link to these results)