Bacterial taxon 909946
Locus STM474_4647
Protein WP_001268859.1
anaerobic ribonucleoside-triphosphate reductase-activating protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 154 aa, Gene nrdG, UniProt E8XBK3
>WP_001268859.1|Salmonella enterica Serovar Typhimurium ST4 74|anaerobic ribonucleoside-triphosphate reductase-activating protein
MRYHQYYPVDIVNGPGTRCTLFVSGCVHECPGCYNKSTWRLNSGQPFTKEMEDKIIADLNDTRIHRQGISLSGGDPLHPQNVPDILALVQRIHAECPGKDIWVWTGYKLDELNAAQMQVVDLINVLVDGKFVQDLKDPALIWRGSSNQVVHHLR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,712,751 | -6.72 | 2.2e-8 | ●●●●○ -3.32 | -3.31506361586413 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,712,751 | 0.45 | 0.73 | ○○○○○ 0.41 | 0.411111243491646 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,712,751 | 0.75 | 0.35 | ○○○○○ 0.57 | 0.565732812842182 | 23637626 |
Retrieved 3 of 3 entries in 1.3 ms
(Link to these results)