Bacterial taxon 909946
Locus STM474_2652
Protein WP_000985204.1
anaerobic sulfite reductase subunit A
Salmonella enterica Serovar Typhimurium ST4 74
Length 347 aa, Gene asrA, UniProt E8XGN9
>WP_000985204.1|Salmonella enterica Serovar Typhimurium ST4 74|anaerobic sulfite reductase subunit A
MAIKITPDEFSLLIQRLNKKWRVFAPSAEFRGGRFSDTDNIIYQRISGWRDLIWHEKSHMSPNTIIAPITETLFYFDKDTIQIAETDTSPIIIFARACDINAMSRLDYMYLSNGNNSDYSYQLLREHIRFVLIECEESFENCFCVSMGTNKTDCYSAAMRFSDEGALVSIRDPFIEAAIQGLGQEADYTPSFVSENRETVVTPDSVCHDPQKIRDILTHHPLWDAYDSRCISCGRCTTGCPTCTCYSVFDVAYDENPQRGERRRQWASCMVPGFSDMAGGHGFREKPGERLRYRALHKVNDYKARNGIEHMCVGCGRCDDRCPQYIKFSLIINKMTAAVRQALAEEA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,684,511 | -8.36 | 1.1e-54 | ●●●●● -4.17 | -4.16662821701278 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,684,511 | -4.17 | 0.00023 | ●●○○○ -1.99 | -1.98644329310829 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,684,511 | -3.9 | 0.00019 | ●●○○○ -1.85 | -1.84956228014529 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,684,854 | 1.16 | 0.033 | ○○○○○ 0.78 | 0.780890465756648 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,684,854 | 0.29 | 0.97 | ○○○○○ 0.33 | 0.329517171758501 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,684,854 | 1.31 | 0.43 | ○○○○○ 0.86 | 0.856818344927069 | 23637626 |
Retrieved 6 of 6 entries in 1 ms
(Link to these results)