Bacterial taxon 909946
Locus STM474_3279
Protein WP_000988938.1
anti-adapter protein IraD
Salmonella enterica Serovar Typhimurium ST4 74
Length 126 aa, Gene iraD, UniProt E8XAH9
>WP_000988938.1|Salmonella enterica Serovar Typhimurium ST4 74|anti-adapter protein IraD
MMTPTIPVALFDRLLVEGISPHELVRRKLMCLFNSCAVPGGETLPPLLTRGMPEWHEVNVGDKRVLNWFCRELRAAILRYEPSINMLKVSVKDAHHQTLALSLEAMLQDESEPLRLEIAYSNGRWR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,311,503 | 0.73 | 0.22 | ○○○○○ 0.56 | 0.557356199378056 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,311,503 | 0.78 | 0.59 | ○○○○○ 0.58 | 0.583388287821491 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,311,503 | 1.25 | 0.59 | ○○○○○ 0.82 | 0.823934714045504 | 23637626 |
Retrieved 3 of 3 entries in 1 ms
(Link to these results)