Bacterial taxon 909946
Locus STM474_2333
Protein WP_010989045.1
antitermination protein Q
Salmonella enterica Serovar Typhimurium ST4 74
Length 122 aa, Gene n/a, UniProt E8XDS8
>WP_010989045.1|Salmonella enterica Serovar Typhimurium ST4 74|antitermination protein Q
MMRDIQMVLERWGAWAASDSSGVDYSPIAAGFKGLLPYTCKTRVACSDNDALIVEGCLARLKQKRPDEHSLLVAHYLYRISKRKIAKVRGKDEKLVRIEIQLAEGFIDGCLSMLDLTLDMDV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,337,139 | 0.24 | 0.98 | ○○○○○ 0.3 | 0.30129880832094 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,337,139 | 1.14 | 0.14 | ○○○○○ 0.77 | 0.7677070165393 | 23637626 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)