Bacterial taxon 909946
Locus STM474_4660
Protein WP_000666051.1
ArgR family transcriptional regulator
Salmonella enterica Serovar Typhimurium ST4 74
Length 162 aa, Gene argR, UniProt E8XBL5
>WP_000666051.1|Salmonella enterica Serovar Typhimurium ST4 74|ArgR family transcriptional regulator
MKEYDDYSAKEQQQLAVCQRLISEKSYLSQEEIRRDLQNEGFEGISQSTVSRLLKLLGAIKIRNTKGQKIYSVNPQRRPSPDAGRSIAEMVVSVEHNSEFILIHTAAGYGRAVARILDYHALPEILGVVAGSSIVWVAPRVVQRTALVHKQINYLLKMNLNS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,725,963 | -0.01 | 1 | ○○○○○ 0.17 | 0.174436762404291 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,725,963 | 0.25 | 0.88 | ○○○○○ 0.31 | 0.308674246356649 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,725,963 | 0.76 | 0.32 | ○○○○○ 0.57 | 0.572867541752962 | 23637626 |
Retrieved 3 of 3 entries in 1.7 ms
(Link to these results)