Bacterial taxon 909946
Locus STM474_2734
Protein WP_000002116.1
ASCH domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 93 aa, Gene n/a, UniProt E8XHK6
>WP_000002116.1|Salmonella enterica Serovar Typhimurium ST4 74|ASCH domain-containing protein
MANLQLAVKGEYFDAMIRGEKTEEYRLCNDYWNKRIMFREYDRLIITKGYPKRDDSSRRIDVPYGGYEVKTITHPHFGDEPVKVYAIKVNINC
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,764,047 | -1.13 | 0.39 | ●○○○○ -0.41 | -0.407275290907264 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,764,047 | -1.02 | 0.6 | ●○○○○ -0.35 | -0.350038041945486 | 23637626 |
Retrieved 2 of 2 entries in 1.5 ms
(Link to these results)