Bacterial taxon 909946
Locus STM474_2848
Protein WP_000698372.1
ASCH domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 125 aa, Gene n/a, UniProt E8XJ74
>WP_000698372.1|Salmonella enterica Serovar Typhimurium ST4 74|ASCH domain-containing protein
MKILLSIKPEFAESILNGYKKFEFRKTIFRNKEARVVVIYATMPVGKVIGEFEIDEVLSSQPDELWDMTKKYAGITRDFFDEYFSERDRGFAIAVKNPQRYDTPVSLNELIPGAVPPQSFRYIRG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,879,071 | -2.85 | 0.011 | ●●○○○ -1.3 | -1.30227233588949 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,879,071 | -2.33 | 3.6e-6 | ●●○○○ -1.03 | -1.03106836548328 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,879,071 | 0.03 | 1 | ○○○○○ 0.19 | 0.19035223341892 | 23637626 |
Retrieved 3 of 3 entries in 1 ms
(Link to these results)