Bacterial taxon 909946
Locus STM474_3197
Protein WP_001182976.1
ASCH domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 103 aa, Gene yqfB, UniProt E8X9M1
>WP_001182976.1|Salmonella enterica Serovar Typhimurium ST4 74|ASCH domain-containing protein
MQPNDITFFQRFQNDILAGRKTITIRDASESHFKAGDVLRVGRFEDDGYFCTIEVTGTSTVTLDTLNEKHAQQENMSLDELKRVIAEIYPNQTQFYVIDFKCL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,229,605 | -1.89 | 0.043 | ●○○○○ -0.8 | -0.804372135090781 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,229,605 | -1.53 | 0.013 | ●○○○○ -0.62 | -0.619574447597637 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,229,605 | -0.18 | 0.96 | ○○○○○ 0.08 | 0.0838362891830228 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,229,737 | 0.27 | 0.86 | ○○○○○ 0.32 | 0.319785971021341 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,229,737 | 0.38 | 0.64 | ○○○○○ 0.37 | 0.372797488575928 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,229,737 | 0.76 | 0.82 | ○○○○○ 0.57 | 0.573533798134026 | 23637626 |
Retrieved 6 of 6 entries in 1.2 ms
(Link to these results)