Bacterial taxon 909946
Locus STM474_4376
Protein WP_010989091.1
ASCH domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 135 aa, Gene n/a, UniProt E8X8U4
>WP_010989091.1|Salmonella enterica Serovar Typhimurium ST4 74|ASCH domain-containing protein
MKLYWQEKYPQAFCWSFGDSPALADELAALVVAGKKRGTCSSLVSYQKEQPPVTPGSYHIVLNGTGDAVCVIRTLALRLIRFNEMSADLAALEGEGDLSLAYWQAAHRAFFEREGNWSPEMELVYEEFAVLEIAP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,428,306 | 0.11 | 1 | ○○○○○ 0.23 | 0.234001069984869 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,428,306 | 0.28 | 0.71 | ○○○○○ 0.32 | 0.324391008343838 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,428,306 | 0.89 | 0.65 | ○○○○○ 0.64 | 0.641796909302921 | 23637626 |
Retrieved 3 of 3 entries in 1.7 ms
(Link to these results)