Bacterial taxon 909946
Locus STM474_3922
Protein WP_000766669.1
AsmA family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 569 aa, Gene yicH, UniProt E8XGU8
>WP_000766669.1|Salmonella enterica Serovar Typhimurium ST4 74|AsmA family protein
MKLIGRLLLYVLIACLVVIFGFYFLLQTRWGADHVSNWVSENSGYHLTFDVMDHRFSAPSHLLLENVTFGRDGQPATLVAKTVDIGLSIRQLTAPLHVDTILLQDGTLNISVQTAPFPFEADRLQLRNMALNSPGSEWRLSAQRVNGGVMPWRPEAGRVLGNKAQIQLSAGSLTLNDVPATNVLIEGSIDHNQVMLNTVGADMARGALTGVARRNADGSWVVENLRLNDIRLQSDKSLSEFFAPLTTVPSLQISRLEVTDSSLQGPDWAVTDLDLSLRNLTLRKEDWQSQEGKLSMNASEFIYGSLHLLDPILNAEFSPQGVALRQFTTRWEGGMVRTSGAWLREGKALILDDTAIAGLEYTLPENWKQLWMKPLPDWLNSLTLKKFSASRNLVIDIDPAFPWQITALDGYGANLELVQHHQWGVWSGNATLNAAAATFNRVDVRRPSLSLTANASTVNISDLSAFTGKGILEATASVSQLPQRQTQISLNGRGVPMDVLQQWGWPALPIAGDGNIQLTASGNIQADAPLKPTVNGQLHAVNAQKQQITQTMQAGVVSGGEVTSTEPTL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,965,404 | -0.74 | 0.76 | ●○○○○ -0.21 | -0.209562825822931 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,965,404 | -0.72 | 0.55 | ●○○○○ -0.2 | -0.198078530235568 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,965,404 | -0.67 | 0.21 | ●○○○○ -0.17 | -0.168800462523115 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,965,322 | -0.22 | 0.78 | ○○○○○ 0.06 | 0.0634297184959936 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,965,322 | -0.21 | 0.91 | ○○○○○ 0.07 | 0.0654724029693728 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,965,406 | 0 | 1 | ○○○○○ 0.18 | 0.177835285699186 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,964,525 | 0.23 | 0.74 | ○○○○○ 0.3 | 0.295776644580589 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,964,525 | 0.28 | 0.87 | ○○○○○ 0.32 | 0.324686956456477 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,965,591 | 0.3 | 0.96 | ○○○○○ 0.33 | 0.333810444719175 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,965,322 | 0.49 | 0.96 | ○○○○○ 0.43 | 0.43018472341926 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,964,525 | 0.64 | 0.87 | ○○○○○ 0.51 | 0.509947814518765 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,965,591 | 0.82 | 0.35 | ○○○○○ 0.6 | 0.603807142898279 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,965,406 | 0.98 | 0.19 | ○○○○○ 0.69 | 0.685884217829816 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,965,591 | 1.45 | 0.56 | ○○○○○ 0.93 | 0.930147413796913 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,965,406 | 1.82 | 0.44 | ○○○○○ 1.12 | 1.12038143892486 | 23637626 |
Retrieved 15 of 15 entries in 1.5 ms
(Link to these results)