Bacterial taxon 909946
Locus STM474_4136
Protein WP_000247124.1
ATP-dependent DNA helicase RecQ
Salmonella enterica Serovar Typhimurium ST4 74
Length 615 aa, Gene recQ, UniProt E8XJE6
>WP_000247124.1|Salmonella enterica Serovar Typhimurium ST4 74|ATP-dependent DNA helicase RecQ
MVNGVNVAQAEVLNLESGAKQVLQETFGYQQFRPGQEAIIDTALSGRDCLVVMPTGGGKSLCYQIPALLLDGLTVVVSPLISLMKDQVDQLLANGVAAACLNSTQSREQQLEVMAGCRTGQIRLLYIAPERLMLDNFLDHLAHWNPVLLAVDEAHCISQWGHDFRPEYAALGQLRQRFPALPFMALTATADDTTRQDIIRLLGLNDPLIQISSFDRPNIRYMLMEKFKPLDQLMRYVQEQRGKSGIIYCNSRAKVEDTAARLQSRGISAAAYHAGLENAIRVDVQEKFQRDDLQIVVATVAFGMGINKPNVRFVVHFDIPRNIESYYQETGRAGRDGLPAEAMLFYDPADMAWLRRCLEEKPAGQLQDIERHKLNAMGAFAEAQTCRRLVLLNYFGEGRQEPCGNCDICLDPPKQYDGLNDAQIALSTIGRVNQRFGMGYVVEVIRGANNQRIRDFGHDKLKVYGMGREKSHEHWVSVIRQLIHLGLVMQNIAQHSALQLTDAARPVLRGDVPLKLAVPRIVALKPRVMQKSFGGNYDRKLFAKLRKLRKAIADEENIPPYVVFNDATLIEMAEQMPVSASEMLSVNGVGMRKLERFGKEFMALIRAHVDGDDEE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,185,270 | -2.09 | 0.075 | ●○○○○ -0.91 | -0.905858994528965 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,184,870 | -0.92 | 0.67 | ●○○○○ -0.3 | -0.30016937814234 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,185,281 | -0.69 | 0.36 | ●○○○○ -0.18 | -0.179017148783042 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,184,417 | -0.54 | 0.84 | ●○○○○ -0.1 | -0.104047790087683 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,184,417 | -0.53 | 0.69 | ●○○○○ -0.1 | -0.0986995957407111 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,184,417 | -0.5 | 0.52 | ●○○○○ -0.08 | -0.0848796858244975 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,184,870 | -0.4 | 0.81 | ●○○○○ -0.03 | -0.0313804964321629 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,185,607 | -0.17 | 0.97 | ○○○○○ 0.09 | 0.0865224508164824 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,184,870 | -0 | 1 | ○○○○○ 0.18 | 0.176156738477386 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,184,229 | 0.03 | 0.99 | ○○○○○ 0.19 | 0.193100050692798 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,185,281 | 0.19 | 0.93 | ○○○○○ 0.28 | 0.275057892002699 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,185,281 | 0.21 | 0.99 | ○○○○○ 0.28 | 0.28414843961324 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,184,560 | 0.37 | 0.91 | ○○○○○ 0.37 | 0.369110012857021 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,185,631 | 0.46 | 0.57 | ○○○○○ 0.42 | 0.416866459061345 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,185,270 | 0.48 | 0.55 | ○○○○○ 0.43 | 0.425729824656845 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,184,229 | 0.48 | 0.91 | ○○○○○ 0.43 | 0.42800702438846 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,184,455 | 0.51 | 0.77 | ○○○○○ 0.44 | 0.443501868653949 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,185,631 | 0.55 | 0.89 | ○○○○○ 0.46 | 0.460296239329714 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,184,560 | 0.63 | 0.87 | ○○○○○ 0.51 | 0.50666892991099 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,184,455 | 0.73 | 0.36 | ○○○○○ 0.56 | 0.555397720228972 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,184,455 | 0.74 | 0.83 | ○○○○○ 0.56 | 0.560955023919329 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,185,607 | 1.09 | 0.16 | ○○○○○ 0.74 | 0.74331572165666 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,185,607 | 1.66 | 0.24 | ○○○○○ 1.04 | 1.0406477815452 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,185,270 | 3.78 | 0.12 | ○○○○○ 2.14 | 2.14189684058935 | 23637626 |
Retrieved 24 of 24 entries in 1.9 ms
(Link to these results)