Bacterial taxon 909946
Locus STM474_4259
Protein WP_000090737.1
autoinducer 2 ABC transporter substrate-binding protein LsrB
Salmonella enterica Serovar Typhimurium ST4 74
Length 340 aa, Gene yneA, UniProt E8XKE4
>WP_000090737.1|Salmonella enterica Serovar Typhimurium ST4 74|autoinducer 2 ABC transporter substrate-binding protein LsrB
MARHSIKMIALLTAFGLASAAMTVQAAERIAFIPKLVGVGFFTSGGNGAQEAGKALGIDVTYDGPTEPSVSGQVQLVNNFVNQGYDAIIVSAVSPDGLCPALKRAMQRGVKILTWDSDTKPECRSYYINQGTPKQLGSMLVEMAAHQVDKEKAKVAFFYSSPTVTDQNQWVKEAKAKISQEHPGWEIVTTQFGYNDATKSLQTAEGIIKAYPDLDAIIAPDANALPAAAQAAENLKRNNLAIVGFSTPNVMRPYVQRGTVKEFGLWDVVQQGKISVYVANALLKNMPMNVGDSLDIPGIGKVTVSPNSEQGYHYEAKGNGIVLLPERVIFNKDNIDKYDF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,309,457 | -3.76 | 7.0e-8 | ●●○○○ -1.78 | -1.77502080302575 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,309,500 | -2.55 | 0.02 | ●●○○○ -1.15 | -1.14693158523658 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,309,500 | -2.45 | 0.006 | ●●○○○ -1.1 | -1.0969392575379 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,308,634 | -3.24 | 0.26 | ●●○○○ -1.5 | -1.50465692752668 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,309,457 | -1.94 | 0.22 | ●○○○○ -0.83 | -0.828216904198183 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,309,501 | -1.58 | 0.12 | ●○○○○ -0.64 | -0.64150124929745 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,309,501 | -0.75 | 0.88 | ●○○○○ -0.21 | -0.21149342088731 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,308,634 | -0.37 | 0.58 | ●○○○○ -0.01 | -0.0131977368073963 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,309,500 | -0.28 | 0.74 | ○○○○○ 0.03 | 0.0326936201723194 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,309,345 | -0.21 | 0.72 | ○○○○○ 0.07 | 0.0661757820440542 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,308,802 | -0.1 | 0.9 | ○○○○○ 0.12 | 0.122614616817635 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,309,345 | -0.03 | 0.99 | ○○○○○ 0.16 | 0.161510381244944 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,309,175 | 0.04 | 0.86 | ○○○○○ 0.2 | 0.195570355007369 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,308,802 | 0.09 | 1 | ○○○○○ 0.22 | 0.22422209385119 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,308,634 | 0.3 | 0.97 | ○○○○○ 0.34 | 0.335204351906417 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,309,345 | 0.58 | 0.89 | ○○○○○ 0.48 | 0.477791656837742 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,309,175 | 0.72 | 0.84 | ○○○○○ 0.55 | 0.549409759744926 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,309,457 | 1.53 | 0.9 | ○○○○○ 0.97 | 0.972671944375131 | 23637626 |
Retrieved 18 of 18 entries in 1.3 ms
(Link to these results)