Bacterial taxon 909946
Locus STM474_3813
Protein WP_000637070.1
autotransporter outer membrane beta-barrel domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 234 aa, Gene yhjY, UniProt E8XFV6
>WP_000637070.1|Salmonella enterica Serovar Typhimurium ST4 74|autotransporter outer membrane beta-barrel domain-containing protein
MIVRKRRGRRTLRCLAGLMACSFFINTTYAWQQEYIAEAAPGHTTERYTWDSDHQPNYNDILAERIQSTQNTVGPVLSLADETPLDATSGISMGWNFPLSRRVTTGPVAALHYDGSTSSMYNEYGDSATTLAFTDPLWHASVSTLGWRVNSQFGDVRPWAQISYNQQFGENIWKAQSGLSRMTAGNQAGNWLDVTVGADVLLNPHLAAYAAFSQAENSATDSDYLYTLGVSARF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,850,102 | 1.73 | 0.011 | ○○○○○ 1.08 | 1.07586934549585 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,850,155 | -2.19 | 0.072 | ●○○○○ -0.96 | -0.958311725807032 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,850,155 | -0.56 | 0.48 | ●○○○○ -0.12 | -0.115960499029133 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,850,155 | -0.3 | 0.93 | ○○○○○ 0.02 | 0.0191151235717993 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,850,102 | 0.18 | 0.99 | ○○○○○ 0.27 | 0.270383997183212 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,850,102 | 0.4 | 0.76 | ○○○○○ 0.38 | 0.384499775865689 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,850,281 | 0.55 | 0.54 | ○○○○○ 0.46 | 0.462449315572266 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,850,281 | 0.74 | 0.58 | ○○○○○ 0.56 | 0.559096116097862 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,850,281 | 1 | 0.75 | ○○○○○ 0.7 | 0.69558081091456 | 23637626 |
Retrieved 9 of 9 entries in 1.3 ms
(Link to these results)