Bacterial taxon 909946
Locus STM474_3608
Protein WP_000675530.1
bacterioferritin
Salmonella enterica Serovar Typhimurium ST4 74
Length 158 aa, Gene bfr, UniProt E8XDY7
>WP_000675530.1|Salmonella enterica Serovar Typhimurium ST4 74|bacterioferritin
MKGDVKIINYLNKLLGNELVAINQYFLHARMFKNWGLTRLNDVEYHESIDEMKHADKYIERILFLEGIPNLQDLGKLGIGEDVEEMLRSDLRLELEGAKDLREAIAYADSVHDYVSRDMMIEILADEEGHIDWLETELDLIAKLGMQNYLQSQIKVTD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,619,062 | -0.2 | 0.95 | ○○○○○ 0.07 | 0.0707300475240857 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,619,062 | 1 | 0.22 | ○○○○○ 0.7 | 0.697439513606712 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,619,062 | 1.16 | 0.62 | ○○○○○ 0.78 | 0.781806906679067 | 23637626 |
Retrieved 3 of 3 entries in 1.6 ms
(Link to these results)