Bacterial taxon 909946
Locus STM474_4394
Protein WP_001093501.1
baseplate protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 119 aa, Gene n/a, UniProt E8X8W2
>WP_001093501.1|Salmonella enterica Serovar Typhimurium ST4 74|baseplate protein
MNTKTRPSTLHWQPALQRPEEYVCGLDDIHQAIHIILRTPRGSDPHRPLFGSNLWRYIDYPIERAIPHVVRESVEAIRMWEPRCRLLKVTPTIDGEHLTLRVQWRAADGVINSTEVLWR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,445,231 | -0.1 | 0.9 | ○○○○○ 0.12 | 0.124571183330596 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,445,231 | 0.09 | 0.88 | ○○○○○ 0.22 | 0.224816831766628 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,445,231 | 0.66 | 0.86 | ○○○○○ 0.52 | 0.518329371339733 | 23637626 |
Retrieved 3 of 3 entries in 1.8 ms
(Link to these results)