Bacterial taxon 909946
Locus STM474_0832
Protein WP_000373611.1
Bax inhibitor-1/YccA family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 234 aa, Gene ybhL, UniProt E8XBS0
>WP_000373611.1|Salmonella enterica Serovar Typhimurium ST4 74|Bax inhibitor-1/YccA family protein
MDRFPRSDSIVQARSGLQTYMAQVYGWMTVGLLLTAFIAWYAANTPAVMMFVFSSKITFFGLIIAQLALVFVLSGLVHKLSAGMATTLFMLYSALTGLTLSSIFIVYTYSSIASTFVVTGGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVVVFVGLTAYDTQKLKNIGEQIDTRDSANLRKYSILGALTLYLDFINLFLMLLRIFGNRR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 873,205 | 1.81 | 0.013 | ○○○○○ 1.12 | 1.118364885849 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 873,205 | 0.64 | 0.56 | ○○○○○ 0.51 | 0.507419094049014 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 873,163 | 1.02 | 0.72 | ○○○○○ 0.7 | 0.704351036375966 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 873,163 | 1.25 | 0.7 | ○○○○○ 0.83 | 0.826602245782612 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 873,205 | 1.93 | 0.36 | ○○○○○ 1.18 | 1.17842836081802 | 23637626 |
Retrieved 5 of 5 entries in 0.7 ms
(Link to these results)