Bacterial taxon 909946
Locus STM474_1110
Protein WP_000749201.1
bifunctional glucose-1-phosphatase/inositol phosphatase
Salmonella enterica Serovar Typhimurium ST4 74
Length 413 aa, Gene agp, UniProt E8XE74
>WP_000749201.1|Salmonella enterica Serovar Typhimurium ST4 74|bifunctional glucose-1-phosphatase/inositol phosphatase
MKKSLLAVAVAGAVLLSSAVQAQTTPEGYQLQQVLMMSRHNLRAPLANNGSVLAQSTPNAWPAWDVPGGQLTTKGGVLEVYMGHYTREWLVAQGLIPSGECPAPDTVYAYANSLQRTVATAQFFITGAFPGCDIPVHHQEKMGTMDPTFNPVITDDSAAFRQQAVQAMEKARSQLHLDESYKLLEQITHYQDSPSCKEKHQCSLIDAKDTFSANYQQEPGVQGPLKVGNSLVDAFTLQYYEGFPMDQVAWGGIHTDRQWKVLSKLKNGYQDSLFTSPTVARNVAAPLVKYIDKVLVADRVSAPKVTVLVGHDSNIASLLTALDFKPYQLHDQYERTPIGGQLVFQRWHDGNANRDLMKIEYVYQSARQLRNAEALTLKSPAQRVTLELKGCPVDANGFCPLDKFDNVMNTAAK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,160,317 | -1.12 | 0.032 | ●○○○○ -0.4 | -0.401970913220681 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,160,548 | -0.07 | 0.98 | ○○○○○ 0.14 | 0.140419214058114 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,160,317 | -0.03 | 0.99 | ○○○○○ 0.16 | 0.159167606085386 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,160,548 | 0.26 | 0.76 | ○○○○○ 0.31 | 0.310044710119377 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,160,548 | 0.32 | 0.83 | ○○○○○ 0.34 | 0.34384945315929 | 23637626 |
Retrieved 5 of 5 entries in 1.6 ms
(Link to these results)