Bacterial taxon 909946
Locus STM474_3190
Protein WP_000745625.1
bifunctional protein-disulfide isomerase/oxidoreductase DsbC
Salmonella enterica Serovar Typhimurium ST4 74
Length 237 aa, Gene dsbC, UniProt E8X9L4
>WP_000745625.1|Salmonella enterica Serovar Typhimurium ST4 74|bifunctional protein-disulfide isomerase/oxidoreductase DsbC
MKKRFMMFTLLAAVFSGVAHADDAAIRQSLAKLGVQSTEIQASPVAGMKTVLTHSGVLYVTDDGKHIIQGPMYDVSGAHPVNVTNKLLMSQLNALEKEMIVYKAPDEKHVITVFTDITCGYCHKLHEEMKDYNALGITVRYLAFPRQGLESQAEQDMKSIWCAKDKNKAFDDAMAGKGVKPASCDVNIADHYALGVQLGVSGTPAIVLSNGYVVPGYQGPKEMKAFLDEHQKQTSGK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,225,093 | -1.92 | 0.00015 | ●○○○○ -0.82 | -0.819053690436479 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,224,500 | -1.3 | 0.4 | ●○○○○ -0.5 | -0.497829440735979 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,224,500 | -0.89 | 0.44 | ●○○○○ -0.29 | -0.287494645991865 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,225,093 | -0.35 | 0.94 | ●○○○○ -0.01 | -0.00532434294449155 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,224,667 | -0.29 | 0.93 | ○○○○○ 0.03 | 0.027170647339631 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,224,667 | 0.4 | 0.79 | ○○○○○ 0.38 | 0.38358029331694 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,224,500 | 0.67 | 0.42 | ○○○○○ 0.53 | 0.526099133872522 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,224,667 | 0.97 | 0.2 | ○○○○○ 0.68 | 0.678982978011381 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,225,093 | 1.73 | 0.16 | ○○○○○ 1.08 | 1.07510929516345 | 23637626 |
Retrieved 9 of 9 entries in 1.2 ms
(Link to these results)