Bacterial taxon 909946
Locus STM474_0735
Protein WP_000932050.1
biotin-dependent carboxyltransferase family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 310 aa, Gene ybgK, UniProt E8XAU7
>WP_000932050.1|Salmonella enterica Serovar Typhimurium ST4 74|biotin-dependent carboxyltransferase family protein
MLNIIRAGIYTSVQDSGRHGFRQSGLSHCGALDKPAFQTANLLVGNDANAPALEITLGQLVVEFENETWFALTGAGCEAQLDDQPVWTGWRLPVKAGQRLTLHRPLHGMRSYLAVAGGIAVPEVMGSYSTDLKSGIGGLEGRLLKDGDRLATGKPSRQFSGPQGVKQLLWGNRIRALPGPEYREFDRASQEAFWRSPWQLSPQSNRMGYRLQGQSLTRTTDRELLSHGLLPGVVQVPYNGQPIVLMNDAQTTGGYPRIACIIEADMYHLAQIPLGQPIHFVQCSLEEALNARRERQRYLEQLTWRLQHEH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 779,197 | -0.78 | 0.14 | ●○○○○ -0.23 | -0.230124435843078 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 779,197 | -0.55 | 0.66 | ●○○○○ -0.11 | -0.106480997674373 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 779,197 | 0.75 | 0.86 | ○○○○○ 0.57 | 0.56860534043076 | 23637626 |
Retrieved 3 of 3 entries in 2 ms
(Link to these results)