Bacterial taxon 909946
Locus STM474_0775
Protein WP_000097552.1
cell division protein CpoB
Salmonella enterica Serovar Typhimurium ST4 74
Length 262 aa, Gene ybgF, UniProt E8XAY5
>WP_000097552.1|Salmonella enterica Serovar Typhimurium ST4 74|cell division protein CpoB
MSSNFRHHLLSLSLLVGIAAPWAAFAQAPISSVGSGSVEDRVTQLERISNAHSQLLTQLQQQLSDNQSDIDSLRGQIQENQYQLNQVMERQKQIMLQLGSLNNGGAAQPAAGDQSGAATTATPAPDAGTATSGAPVQSGDANTDYNAAIALVQDKSRQDDAIVAFQNFIKKYPDSTYQPNANYWLGQLNYNKGKKDDAAYYFASVVKNYPKSPKAADAMYKVGVIMQDKGDTAKAKAVYQQVINKYPGTDGAKQAQKRLNAM
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 817,341 | -0.6 | 0.82 | ●○○○○ -0.14 | -0.136954466598684 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 817,352 | -0.41 | 0.93 | ●○○○○ -0.04 | -0.0378362405580317 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 817,341 | 0.2 | 0.81 | ○○○○○ 0.28 | 0.280158174329541 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 817,352 | 0.27 | 0.84 | ○○○○○ 0.32 | 0.316221185482862 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 817,352 | 0.79 | 0.15 | ○○○○○ 0.59 | 0.588623427872708 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 817,341 | 1.33 | 0.38 | ○○○○○ 0.87 | 0.870216925980638 | 23637626 |
Retrieved 6 of 6 entries in 1.7 ms
(Link to these results)