Bacterial taxon 909946
Locus STM474_2463
Protein WP_000157037.1
cell division protein DedD
Salmonella enterica Serovar Typhimurium ST4 74
Length 224 aa, Gene dedD, UniProt E8XF19
>WP_000157037.1|Salmonella enterica Serovar Typhimurium ST4 74|cell division protein DedD
MASKFQNRLVGTIVLVALGVIVLPGLLDGQKKHYQDEFAAIPLVPKPGDRDEPDMMPAATQALPTQPPEGAAEEVRAGDAAAPSLDPSRMASNNVELDPIPVETPKPKPVEKPKPQPKPQQPVVAASTPTPAPQPVADDKPAPTGKAYVVQLGALKNADKVNEIVGKLRSAGFRVYTSPSTPVQGKITRILVGPDASKDKMKGSLGELKQISGLSGVVMGYSPN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,474,807 | -1.49 | 0.28 | ●○○○○ -0.6 | -0.598273438314348 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,474,807 | -1.06 | 0.64 | ●○○○○ -0.37 | -0.374629675465165 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,474,807 | -0.03 | 0.97 | ○○○○○ 0.16 | 0.161552027169793 | 23637626 |
Retrieved 3 of 3 entries in 1.8 ms
(Link to these results)