Bacterial taxon 909946
Locus STM474_4242
Protein WP_001233463.1
cell-envelope stress modulator CpxP
Salmonella enterica Serovar Typhimurium ST4 74
Length 166 aa, Gene cpxP, UniProt E8XKC7
>WP_001233463.1|Salmonella enterica Serovar Typhimurium ST4 74|cell-envelope stress modulator CpxP
MRKVTAAVMASTLAFSFLSHAAEVVTSDNWHPGDGATQRSAQNHMFDGISLTEHQRQQMRDLMQQARHEQPPVNVSEMETMHRLVTAEKFDESAVRAQAEKMAQEQVARQVEMARVRNQMYRLLTPEQQAVLNEKHQQRMEQLRDVAQWQKSSSLKLLSSSNSRSQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,292,110 | 1.29 | 0.024 | ○○○○○ 0.85 | 0.845098568675401 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,292,110 | -0.11 | 0.97 | ○○○○○ 0.12 | 0.118670905502227 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,292,110 | 0.41 | 0.75 | ○○○○○ 0.39 | 0.392529508387146 | 23637626 |
Retrieved 3 of 3 entries in 0.5 ms
(Link to these results)