Bacterial taxon 909946
Locus STM474_3792
Protein WP_000988321.1
cellulose biosynthesis protein BcsF
Salmonella enterica Serovar Typhimurium ST4 74
Length 63 aa, Gene yhjT, UniProt E8XFD6
>WP_000988321.1|Salmonella enterica Serovar Typhimurium ST4 74|cellulose biosynthesis protein BcsF
MMTISDIVQIILFCALIFFPLGYLARHSLRRISDTTRLLFAKPRYVKPAGTLRRATKVKADKK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,827,643 | -0.08 | 0.92 | ○○○○○ 0.14 | 0.137914711830443 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,827,643 | -0.04 | 0.99 | ○○○○○ 0.16 | 0.157014233314127 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,827,643 | 0.03 | 1 | ○○○○○ 0.2 | 0.195154460773295 | 23637626 |
Retrieved 3 of 3 entries in 1.9 ms
(Link to these results)