Bacterial taxon 909946
Locus STM474_1270
Protein WP_000617985.1
chorismate mutase
Salmonella enterica Serovar Typhimurium ST4 74
Length 181 aa, Gene n/a, UniProt E8XFJ5
>WP_000617985.1|Salmonella enterica Serovar Typhimurium ST4 74|chorismate mutase
MIRHIAIFLCSLLMCSTTFADSVTSVSLGALLTALNERMLLMKDVAAYKMKHHLPIEDFTREQNVFAEAEEEAKNNGLDPHSITPFIRSLMDASKAIQYRYLAQWRTGSEPSFPIQTLSVTRQRIRQLDNQMLIIISQRLMVGAFSHDDMVWLRAQFNAPNLNESDISNVLAALSLVRRAR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,307,081 | -3.24 | 2.2e-10 | ●●○○○ -1.51 | -1.50774911225997 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,307,081 | -1.39 | 0.36 | ●○○○○ -0.55 | -0.545905875170071 | 23637626 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)