Bacterial taxon 909946
Locus STM474_3501
Protein WP_000366112.1
ClpXP protease specificity-enhancing factor
Salmonella enterica Serovar Typhimurium ST4 74
Length 166 aa, Gene sspB, UniProt E8XD44
>WP_000366112.1|Salmonella enterica Serovar Typhimurium ST4 74|ClpXP protease specificity-enhancing factor
MDLSQLTPRRPYLLRAFYEWLLDNQLTPHLVVDVMLPGVHVPMEYARDGQIVLNIAPRAVGNLELSNDEVRFNARFGGVPRQVSVPLAAVLAIYARENGAGTMFEPEAAYDEDVVSLNDDDNTAGAESETVMSVIDGDKPDHDDDSSPDDEPPPPRGGRPALRVVK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,531,551 | -0.51 | 0.89 | ●○○○○ -0.09 | -0.0903287503052067 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,531,476 | -0.09 | 0.98 | ○○○○○ 0.13 | 0.127850014968269 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,531,476 | 0.27 | 0.75 | ○○○○○ 0.32 | 0.31511101679982 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,531,551 | 0.55 | 0.71 | ○○○○○ 0.46 | 0.462801583885865 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,531,551 | 0.6 | 0.44 | ○○○○○ 0.49 | 0.49043245540631 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,531,527 | 0.67 | 0.86 | ○○○○○ 0.52 | 0.524862687582948 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,531,527 | 1.36 | 0.64 | ○○○○○ 0.89 | 0.885308440831762 | 23637626 |
Retrieved 7 of 7 entries in 1.8 ms
(Link to these results)