Bacterial taxon 909946
Locus STM474_3269
Protein WP_001112898.1
CoA ester lyase
Salmonella enterica Serovar Typhimurium ST4 74
Length 280 aa, Gene cilB, UniProt E8XAG9
>WP_001112898.1|Salmonella enterica Serovar Typhimurium ST4 74|CoA ester lyase
MPDISHTPTRSWLFTPAIRPERFIKAVESAADISIIDLEDSVTPNDKAQARKIAMQFLSSRPNSSLKIALRINGMNTHAGIEDLHMLLECRFFPDYIILPKTESAAHLQIVDSLIMMAGSDTRLIGIIESVVGLNAVESIADATPRLCGLMFGAADMAADIGATPAWEPLALARARIVAACAMKGLLAIDAPFFDIGDFSGLKEETLQALSFGFSAKSAIHPAQISVINAAFTPTTAEINHARAVLTENAKGVGIVSGMMIDEAVARQARRLLARAGIFS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,299,541 | -5.48 | 4.1e-30 | ●●●○○ -2.67 | -2.66861771787241 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,299,838 | -2.94 | 8.0e-9 | ●●○○○ -1.35 | -1.34782412803234 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,299,541 | -0.65 | 0.8 | ●○○○○ -0.16 | -0.162816408843726 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,299,838 | -0.64 | 0.6 | ●○○○○ -0.16 | -0.156174896493985 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,299,838 | -0.37 | 0.9 | ●○○○○ -0.01 | -0.0140121609491712 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,299,541 | -0.3 | 0.83 | ○○○○○ 0.02 | 0.0202769329108382 | 23637626 |
Retrieved 6 of 6 entries in 0.8 ms
(Link to these results)