Bacterial taxon 909946
Locus STM474_0930
Protein WP_000447499.1
cold shock-like protein CspD
Salmonella enterica Serovar Typhimurium ST4 74
Length 73 aa, Gene cspD, UniProt E8XCQ1
>WP_000447499.1|Salmonella enterica Serovar Typhimurium ST4 74|cold shock-like protein CspD
METGTVKWFNNAKGFGFICPEGGGEDIFAHYSTIQMDGYRTLKAGQSVRFDVHQGPKGNHASVIVPIEAEAVA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 978,502 | 1.76 | 0.017 | ○○○○○ 1.09 | 1.09169691989713 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 978,502 | -0.33 | 0.93 | ○○○○○ 0.01 | 0.00669858795021716 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 978,502 | 0.5 | 0.69 | ○○○○○ 0.44 | 0.435928487580015 | 23637626 |
Retrieved 3 of 3 entries in 0.9 ms
(Link to these results)