Bacterial taxon 909946
Locus STM474_1907
Protein WP_000168393.1
CopC domain-containing protein YobA
Salmonella enterica Serovar Typhimurium ST4 74
Length 124 aa, Gene yobA, UniProt E8X9E2
>WP_000168393.1|Salmonella enterica Serovar Typhimurium ST4 74|CopC domain-containing protein YobA
MASSAPSRRLALLLLASTFATPAAWAHAHLTHQYPAANAAVTASPQALTLNFSEGIEPGFSGATITGPQQELIKTRPAKRNEQDKTQLIIPLEQPLKSGAYTVDWHVVSVDGHKTKGKYTFSVK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,927,474 | 0.36 | 0.95 | ○○○○○ 0.36 | 0.364901706536025 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,927,474 | 0.92 | 0.71 | ○○○○○ 0.65 | 0.65430156743975 | 23637626 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)