Bacterial taxon 909946
Locus STM474_4434
Protein WP_000981150.1
CsbD family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 70 aa, Gene yjbJ, UniProt E8X902
>WP_000981150.1|Salmonella enterica Serovar Typhimurium ST4 74|CsbD family protein
MMNKDEAGGNWKQFKGKMKEQWGKLTDDDMTVIEGKRDQLVGKIQERYGYQKDQAEKEVVDWETRNNYRW
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,482,843 | 0.1 | 1 | ○○○○○ 0.23 | 0.227773022514931 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,482,843 | 0.54 | 0.52 | ○○○○○ 0.46 | 0.458221645563216 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,482,843 | 1.84 | 0.43 | ○○○○○ 1.13 | 1.13045741530281 | 23637626 |
Retrieved 3 of 3 entries in 1.2 ms
(Link to these results)