Bacterial taxon 909946
Locus STM474_1227
Protein WP_000456516.1
cupin domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 373 aa, Gene ycfD, UniProt E8XFF7
>WP_000456516.1|Salmonella enterica Serovar Typhimurium ST4 74|cupin domain-containing protein
MEYQLTLNWPDFLERHWQKRPVVLKRGFSNFIDPLSPDELAGLAMESEIDSRLVSHQDGKWQVSHGPFESYDHLGESNWSLLVQAVNHWHEPTAALMRPFRALPDWRIDDLMISFSVPGGGVGPHLDQYDVFIIQGTGRRRWRVGEKLQMRQHCPHPDLLQVEPFEAIIDEELEPGDILYIPPGFPHEGYALENAMNYSVGFRAPNSRELISGFADYVLQRELGNTYYSDPDMPSRKHPADILPQEMDKLRNMMLDLINQPAHFQQWLGEFLSQSRHELDIAPPEPPYQPDEIYDALKQGEVLVRLGGLRVLRIGDEVYANGEKIDSPHRPALEALASHIALTAENFGDALEDPSFLAMLAALVNSGYWFFEG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,273,980 | -1.93 | 0.00033 | ●○○○○ -0.83 | -0.82640780696763 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,273,735 | -0.53 | 0.34 | ●○○○○ -0.1 | -0.095910277950106 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,273,735 | 0.32 | 0.81 | ○○○○○ 0.35 | 0.345572025805997 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,273,980 | 0.85 | 0.79 | ○○○○○ 0.62 | 0.618151829169841 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,273,735 | 0.9 | 0.78 | ○○○○○ 0.64 | 0.64260355255221 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,273,980 | 0.97 | 0.53 | ○○○○○ 0.68 | 0.678464611038336 | 23637626 |
Retrieved 6 of 6 entries in 0.8 ms
(Link to these results)