Bacterial taxon 909946
Locus STM474_1134
Protein WP_001137620.1
curli production assembly/transport protein CsgG
Salmonella enterica Serovar Typhimurium ST4 74
Length 277 aa, Gene csgG, UniProt E8XEQ7
>WP_001137620.1|Salmonella enterica Serovar Typhimurium ST4 74|curli production assembly/transport protein CsgG
MPRLLILVAVLLLSGCLTAPPKQAAKPTLMPRAQSYKDLTHLPAPTGKIFVSVYNIQDETGQFKPYPASNFSTAVPQSATAMLVTALKDSRWFIPLERQGLQNLLNERKIIRAAQENGTVAMNNRIPLQSLTAANIMVEGSIIGYESNVKSGGVGARYFGIGADTQYQLDQIAVNLRVVNVSTGEILSSVNTSKTILSYEVQAGVFRFIDYQRLLEGEIGYTSNEPVMLCLMSAIETGVIFLINDGIDRGLWDLQNKADRQNDILVKYRELSVPPES
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,184,630 | -6.17 | 1.7e-16 | ●●●●○ -3.03 | -3.02752901763613 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,184,630 | -5.9 | 2.7e-18 | ●●●○○ -2.89 | -2.88601864991945 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,184,630 | -2.83 | 0.014 | ●●○○○ -1.29 | -1.29125384223897 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,184,307 | -2.2 | 3.2e-5 | ●○○○○ -0.97 | -0.967862466236099 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,184,307 | -0.88 | 0.69 | ●○○○○ -0.28 | -0.280411434659493 | 23637626 |
Retrieved 5 of 5 entries in 1.7 ms
(Link to these results)