Bacterial taxon 909946
Locus STM474_0768
Protein WP_000875305.1
cyd operon protein YbgE
Salmonella enterica Serovar Typhimurium ST4 74
Length 93 aa, Gene ybge, UniProt E8XAX8
>WP_000875305.1|Salmonella enterica Serovar Typhimurium ST4 74|cyd operon protein YbgE
MKYIYAVMDKRPLRALSFVMAIVLAGCMFWDPSRFAARTSTLEIWHGLLLMWAVCAGIIHGVGFRPESVHWQGIFCPLLADIVLIVGLIFFFL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 811,982 | 1.15 | 0.4 | ○○○○○ 0.77 | 0.774522618244121 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 811,982 | 1.3 | 0.79 | ○○○○○ 0.85 | 0.849884845797392 | 23637626 |
Retrieved 2 of 2 entries in 1.2 ms
(Link to these results)