Bacterial taxon 909946
Locus STM474_3131
Protein WP_000184198.1
cysteine desulfurase sulfur acceptor subunit CsdE
Salmonella enterica Serovar Typhimurium ST4 74
Length 147 aa, Gene ygdK, UniProt E8X8S0
>WP_000184198.1|Salmonella enterica Serovar Typhimurium ST4 74|cysteine desulfurase sulfur acceptor subunit CsdE
MTNPLYTGHPFGTTVTEETLRAIFLPLTQWEDKYRQLILLGKQLPALPDECKAQAKEIAGCENRVWLGFTRSDNGTMHFFGDSEGRIVRGLLAVLLTAVEGKNAAELQARSPLALFDELGLRAQLSASRSQGLNALSEAIVAATHKG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,158,907 | 0.31 | 0.96 | ○○○○○ 0.34 | 0.337883229112265 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,158,907 | 0.75 | 0.32 | ○○○○○ 0.56 | 0.564901674036752 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,158,907 | 0.95 | 0.59 | ○○○○○ 0.67 | 0.668456396922631 | 23637626 |
Retrieved 3 of 3 entries in 1.5 ms
(Link to these results)