Bacterial taxon 909946
Locus STM474_1378
Protein WP_000729468.1
cysteine desulfuration protein SufE
Salmonella enterica Serovar Typhimurium ST4 74
Length 138 aa, Gene sufE, UniProt E8XH67
>WP_000729468.1|Salmonella enterica Serovar Typhimurium ST4 74|cysteine desulfuration protein SufE
MAALPDKEKLLRNFTRCANWEEKYLYIIELGQRLAELNPQDRNPQNTIHGCQSQVWIVMRRNANGIIELQGDSDAAIVKGLMAVVFILYHQMTAQDIVHFDVRPWFEKMALAQHLTPSRSQGLEAMIRAIRAKAATLS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,414,485 | -1.62 | 0.25 | ●○○○○ -0.66 | -0.662898117846721 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,414,485 | -1.12 | 0.33 | ●○○○○ -0.4 | -0.402264012372753 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,414,485 | -0.43 | 0.45 | ●○○○○ -0.05 | -0.0451594604597732 | 23637626 |
Retrieved 3 of 3 entries in 1.5 ms
(Link to these results)