Bacterial taxon 909946
Locus STM474_2532
Protein WP_000036904.1
cysteine synthase A
Salmonella enterica Serovar Typhimurium ST4 74
Length 323 aa, Gene cysK, UniProt E8XFN8
>WP_000036904.1|Salmonella enterica Serovar Typhimurium ST4 74|cysteine synthase A
MSKIYEDNSLTIGHTPLVRLNRIGNGRILAKVESRNPSFSVKCRIGANMIWDAEKRGVLKPGVELVEPTSGNTGIALAYVAAARGYKLTLTMPETMSIERRKLLKALGANLVLTEGAKGMKGAIQKAEEIVASDPQKYLLLQQFSNPANPEIHEKTTGPEIWEDTDGQVDVFISGVGTGGTLTGVTRYIKGTKGKTDLITVAVEPTDSPVIAQALAGEEIKPGPHKIQGIGAGFIPGNLDLKLIDKVVGITNEEAISTARRLMEEEGILAGISSGAAVAAALKLQEDESFTNKNIVVILPSSGERYLSTALFADLFTEKELQQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,541,217 | 0.89 | 0.77 | ○○○○○ 0.64 | 0.639736523467914 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,541,383 | 0.99 | 0.73 | ○○○○○ 0.69 | 0.689184564676438 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,541,383 | 1.2 | 0.16 | ○○○○○ 0.8 | 0.800853086751039 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,541,217 | 1.31 | 0.62 | ○○○○○ 0.86 | 0.856070321404331 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,541,383 | 1.87 | 0.35 | ○○○○○ 1.15 | 1.14829868862624 | 23637626 |
Retrieved 5 of 5 entries in 0.5 ms
(Link to these results)