Bacterial taxon 909946
Locus STM474_4635
Protein WP_001232231.1
cytochrome b562
Salmonella enterica Serovar Typhimurium ST4 74
Length 128 aa, Gene cybC, UniProt E8XBJ1
>WP_001232231.1|Salmonella enterica Serovar Typhimurium ST4 74|cytochrome b562
MRKSLLAILAVSSLVFGSAVFAADLEDNMDILNDNLKVVEKTDSAPELKAALTKMRAAALDAQKATPPKLEDKAPDSPEMKDFRHGFDILVGQIDGALKLANEGNVKEAKAAAEALKTTRNTYHKKYR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,703,907 | -4.43 | 6.5e-16 | ●●●○○ -2.12 | -2.12246320124843 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,703,998 | -1.87 | 0.0094 | ●○○○○ -0.8 | -0.796034395449516 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,703,962 | -1.9 | 0.37 | ●○○○○ -0.81 | -0.810414206091644 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,703,907 | -1.57 | 0.11 | ●○○○○ -0.64 | -0.639226756234169 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,703,881 | -1.15 | 0.31 | ●○○○○ -0.42 | -0.418869099583289 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,703,881 | -0.59 | 0.31 | ●○○○○ -0.13 | -0.129433414792069 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,703,962 | -0.46 | 0.87 | ●○○○○ -0.06 | -0.0640864136611998 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,703,881 | -0.38 | 0.91 | ●○○○○ -0.02 | -0.0195145419144864 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,703,907 | -0.36 | 0.91 | ●○○○○ -0.01 | -0.00826597937838353 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,703,998 | -0.17 | 0.92 | ○○○○○ 0.09 | 0.0906518519392396 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,703,962 | -0.08 | 0.94 | ○○○○○ 0.14 | 0.136832791791041 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,703,998 | 0.05 | 1 | ○○○○○ 0.2 | 0.202022790059827 | 23637626 |
Retrieved 12 of 12 entries in 0.6 ms
(Link to these results)