Bacterial taxon 909946
Locus STM474_4475
Protein WP_001278030.1
cytochrome c nitrite reductase Fe-S protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 223 aa, Gene nrfC, UniProt E8X9T0
>WP_001278030.1|Salmonella enterica Serovar Typhimurium ST4 74|cytochrome c nitrite reductase Fe-S protein
MSCTRRQFITRVGALAAVSGMAGRVVANTLNINGVRYGMVHDESLCIGCTACMDACREVNTVPEGVSRLTIIRSEPQGTFPDVKYRFFRHSCQHCDHAPCVDVCPTGASFRDAASGIVDVNPDLCVGCQYCIAACPYRVRFIHPVSKTADKCDFCRKTNLKAGKQPACVESCPTKALTFGNLDDPNSDISRLLRQKTTYRYKLALGTKPKVYRVPFNYGEVSQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,540,021 | 0.4 | 0.99 | ○○○○○ 0.39 | 0.385228571760829 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,539,916 | 0.87 | 0.83 | ○○○○○ 0.63 | 0.630721821772582 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,539,916 | 1.38 | 0.066 | ○○○○○ 0.9 | 0.895358193893483 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,540,021 | 1.41 | 0.076 | ○○○○○ 0.91 | 0.907714799038155 | 23637626 |
Retrieved 4 of 4 entries in 1 ms
(Link to these results)