Bacterial taxon 909946
Locus STM474_4474
Protein WP_000115065.1
cytochrome c nitrite reductase pentaheme subunit
Salmonella enterica Serovar Typhimurium ST4 74
Length 188 aa, Gene nrfB, UniProt E8X9S9
>WP_000115065.1|Salmonella enterica Serovar Typhimurium ST4 74|cytochrome c nitrite reductase pentaheme subunit
MSVLRSLLTAGVLASGLFWSLSGITATPTPQESDQRWTVTQQRNPDAACLDCHKPDTEGMHGKHTGAINPNNKLPITCTNCHGQPSLHHREGVKDVMRFNDPMYTVEQQNSVCMSCHLPEQLQKAFWPHDVHVTKVTCASCHSLHPQQDTMQTLSEKGRIKICVDCHSDQRTNPHFNPASVPLLKEQP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,539,074 | -0.7 | 0.6 | ●○○○○ -0.19 | -0.185002258229261 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,539,074 | -0.12 | 0.88 | ○○○○○ 0.11 | 0.114357926105782 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,539,074 | 0.16 | 1 | ○○○○○ 0.26 | 0.262025142724648 | 23637626 |
Retrieved 3 of 3 entries in 0.9 ms
(Link to these results)