Bacterial taxon 909946
Locus STM474_0461
Protein WP_000179833.1
cytochrome o ubiquinol oxidase subunit III
Salmonella enterica Serovar Typhimurium ST4 74
Length 204 aa, Gene cyoC, UniProt E8XKM8
>WP_000179833.1|Salmonella enterica Serovar Typhimurium ST4 74|cytochrome o ubiquinol oxidase subunit III
MATDTLTHATAHAHEHGHHDAGQNKIFGFWVYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAAIAMHKNNKSQVISWLALTFLFGAGFIGMELYEFHHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQVARRGLTSTNRTRIMCLSLFWHFLDVIWICVFTVVYLMGAM
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 494,137 | -1.13 | 0.52 | ●○○○○ -0.41 | -0.410059698057854 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 494,137 | 1.23 | 0.079 | ○○○○○ 0.82 | 0.817418027817645 | 23637626 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)