Bacterial taxon 909946
Locus STM474_2957
Protein WP_001279499.1
DedA family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 141 aa, Gene yqaA, UniProt E8XK63
>WP_001279499.1|Salmonella enterica Serovar Typhimurium ST4 74|DedA family protein
MSDGLSLLSLFASSFLSATLLPGNSEVVLVAMLVSGVSHPWVLVLTATMGNSLGGVTNVILGRFFPLRKTSRWQEKATGWLKRYGAATLLLSWMPVIGDLLCLLAGWMRIPWGRTIFFLCLGKALRYVALAAATVQGMMWW
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,991,159 | -1.16 | 0.038 | ●○○○○ -0.43 | -0.426604703151582 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,991,159 | 0.48 | 1 | ○○○○○ 0.43 | 0.425872391088959 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,991,159 | 1.08 | 0.48 | ○○○○○ 0.74 | 0.738193034534749 | 23637626 |
Retrieved 3 of 3 entries in 1.4 ms
(Link to these results)