Bacterial taxon 909946
Locus STM474_3313
Protein WP_000268441.1
DedA family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 219 aa, Gene yghB, UniProt E8XB88
>WP_000268441.1|Salmonella enterica Serovar Typhimurium ST4 74|DedA family protein
MAVIQDIIAALWQHDFAALANPHVVSVVYFVMFATLFLENGLLPASFLPGDSLLLLAGALIAQDVMHFLPTIGILTAAASLGCWLSYIQGRWLGNTRTVKGWLAQLPAKYHQRATCMFDRHGLLALLAGRFLAFVRTLLPTMAGISGLSNRRFQFFNWLSGLLWVTVVTSFGYALSMIPFVKRHEDQVMTFLMILPVALLVAGLLGTLVVVIKKKYCNA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,343,026 | -2.95 | 0.0013 | ●●○○○ -1.35 | -1.35364768282294 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,343,641 | 2.59 | 0.0016 | ○○○○○ 1.52 | 1.52457794892773 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,343,286 | -1.22 | 0.5 | ●○○○○ -0.46 | -0.456169595136315 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,343,286 | -0.94 | 0.21 | ●○○○○ -0.31 | -0.313341947196938 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,343,026 | -0.53 | 0.5 | ●○○○○ -0.1 | -0.0966030728714298 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,343,026 | -0.16 | 0.96 | ○○○○○ 0.1 | 0.0953385364417099 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,343,286 | 0 | 1 | ○○○○○ 0.18 | 0.177108712471057 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,343,372 | 0.88 | 0.77 | ○○○○○ 0.64 | 0.635888086150795 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,343,372 | 1.27 | 0.36 | ○○○○○ 0.84 | 0.83537214926889 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,343,641 | 1.36 | 0.73 | ○○○○○ 0.89 | 0.885160020684096 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,343,372 | 1.42 | 0.053 | ○○○○○ 0.91 | 0.913394101181731 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,343,641 | 1.89 | 0.27 | ○○○○○ 1.16 | 1.15607407481816 | 23637626 |
Retrieved 12 of 12 entries in 1.1 ms
(Link to these results)