Bacterial taxon 909946
Locus STM474_3968
Protein WP_000448638.1
DeoR family transcriptional regulator
Salmonella enterica Serovar Typhimurium ST4 74
Length 261 aa, Gene n/a, UniProt E8XHM8
>WP_000448638.1|Salmonella enterica Serovar Typhimurium ST4 74|DeoR family transcriptional regulator
METKQKERIRRLMELLKKTDRIHLKDAARMLEVSVMTIRRDLSQDDDPLPLTLLGGYIVMVNKPASSTNMPLPAKKTHHRDDLPVAILAAGLVRENDLVFFDNGPEMPLVISMIPDDITFTGICYSHRVFIALNEKPNATAILCGGTYRAKSDAFYDANNPSALDSLNPRKVFISASGVHEHFGVSWFNPDDLAAKRKAMERGLRKILLARHALFDEVAPASIGPLSAFDVLISDRPLPTDYAVHCRNGSVKVITPDSESE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,016,911 | -0.18 | 0.83 | ○○○○○ 0.08 | 0.0832014850981214 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,016,911 | 0.26 | 0.97 | ○○○○○ 0.31 | 0.309925825996549 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,016,911 | 0.66 | 0.68 | ○○○○○ 0.52 | 0.519041470227919 | 23637626 |
Retrieved 3 of 3 entries in 1.9 ms
(Link to these results)