Bacterial taxon 909946
Locus STM474_4354
Protein WP_000362359.1
deoxyribonuclease V
Salmonella enterica Serovar Typhimurium ST4 74
Length 223 aa, Gene nfi, UniProt E8XLB4
>WP_000362359.1|Salmonella enterica Serovar Typhimurium ST4 74|deoxyribonuclease V
MDLASLRAQQIELASSVCREDRLDKDPPAFIGGADVGFEQGGEVTRAAMVLLKYPSLELVEYKVARIATTMPYIPGFLSFREYPALLAAWEQLSQKPDLLFVDGHGISHPRRLGVASHFGLLVDVPTIGVAKKRLCGKFEPLSAEPGALSPLMDKGEQLAWVWRSKARCNPLFIATGHRVSTDSALAWVQRCMKGYRLPEPTRWADAVASGRPAFVRWQEIQR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,407,006 | -6.61 | 2.1e-9 | ●●●●○ -3.25 | -3.25467617367594 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,406,574 | -0.43 | 0.78 | ●○○○○ -0.05 | -0.0472499005957108 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,406,574 | -0.22 | 0.74 | ○○○○○ 0.07 | 0.065381018638355 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,407,006 | -0.04 | 0.96 | ○○○○○ 0.16 | 0.157268293501256 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,407,091 | 0.02 | 1 | ○○○○○ 0.19 | 0.185436468806099 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,406,737 | 0.2 | 0.81 | ○○○○○ 0.28 | 0.283120425480654 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,406,737 | 0.28 | 0.86 | ○○○○○ 0.32 | 0.320504181205179 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,407,091 | 0.52 | 0.91 | ○○○○○ 0.45 | 0.445359889485871 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,406,553 | 0.55 | 0.48 | ○○○○○ 0.46 | 0.46319091101737 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,406,574 | 0.57 | 0.89 | ○○○○○ 0.47 | 0.472200103822127 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,407,006 | 0.6 | 0.89 | ○○○○○ 0.49 | 0.486258428530827 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,406,553 | 0.83 | 0.65 | ○○○○○ 0.61 | 0.609966574352574 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,406,737 | 1.11 | 0.67 | ○○○○○ 0.75 | 0.751793705354602 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,406,553 | 1.65 | 0.92 | ○○○○○ 1.04 | 1.03602025633727 | 23637626 |
Retrieved 14 of 14 entries in 1.8 ms
(Link to these results)