Bacterial taxon 909946
Locus STM474_4181
Protein WP_000743292.1
Der GTPase-activating protein YihI
Salmonella enterica Serovar Typhimurium ST4 74
Length 171 aa, Gene yihI, UniProt E8XJI5
>WP_000743292.1|Salmonella enterica Serovar Typhimurium ST4 74|Der GTPase-activating protein YihI
MKKPTSAPRSKAFGKQRRKTREELNQEARDRKRLKKHRGHAPGSRAAGGNSASGGGNQNQQKDPRIGSKTPVPLGVTEKVTQQHKPKSEKPMLSPQAELDLLETDERLDALLERLEAGETLSAEDQAWVDAKLDRIDELMQKLGLSYDDDEEDDEEDEKQEDMMRLLRGGN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,232,164 | -0.56 | 0.51 | ●○○○○ -0.12 | -0.115124121376783 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,232,164 | 0.42 | 0.94 | ○○○○○ 0.39 | 0.394880912480132 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,232,344 | 0.51 | 0.91 | ○○○○○ 0.44 | 0.440287145380129 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,232,164 | 0.58 | 0.7 | ○○○○○ 0.48 | 0.480266442838368 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,232,344 | 1.02 | 0.22 | ○○○○○ 0.71 | 0.708170703138149 | 23637626 |
Retrieved 5 of 5 entries in 1.1 ms
(Link to these results)