Bacterial taxon 909946
Locus STM474_0953
Protein WP_000534681.1
dimethyl sulfoxide reductase anchor subunit
Salmonella enterica Serovar Typhimurium ST4 74
Length 287 aa, Gene dmsC, UniProt E8XCS3
>WP_000534681.1|Salmonella enterica Serovar Typhimurium ST4 74|dimethyl sulfoxide reductase anchor subunit
MGSGWHEWPLMIFTVFGQCVAGGFIVLALALMKGDLRAETQQRVIACMFGLWVLMGIGFIASMLHLGSPMRAFNSLNRVGASALSNEIASGSVFFAVGGIGWLLAVLKKLPPALRTLWLIITMVLGVVFVWMMVRVYNSIDTVPTWYSVWTPLGFFLTLFMGGPLLGYLLLRIAGVNGWAMRLLPAVSVLALVVIAIMVAMQGAELATIHSSIQQASALVPDYGSLMAWRMVLLAAALCCWIVPQLKGYQPAVPLLSVAFILMLAGELIGRGVFYGLHMTVGMAVAS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,005,591 | 2.14 | 0.003 | ○○○○○ 1.29 | 1.28677769946239 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,005,824 | -0.82 | 0.27 | ●○○○○ -0.25 | -0.247707581706478 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,005,824 | -0.08 | 0.98 | ○○○○○ 0.14 | 0.137827290909386 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,005,824 | 0.84 | 0.47 | ○○○○○ 0.61 | 0.611629644437702 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,005,591 | 0.91 | 0.48 | ○○○○○ 0.65 | 0.649371208525285 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,005,591 | 0.96 | 0.84 | ○○○○○ 0.67 | 0.67428632266624 | 23637626 |
Retrieved 6 of 6 entries in 0.4 ms
(Link to these results)