Bacterial taxon 909946
Locus STM474_4502
Protein WP_000816143.1
dimethylsulfoxide reductase subunit B
Salmonella enterica Serovar Typhimurium ST4 74
Length 208 aa, Gene n/a, UniProt E8X9V7
>WP_000816143.1|Salmonella enterica Serovar Typhimurium ST4 74|dimethylsulfoxide reductase subunit B
MKQYGFYVDSSRCSGCKTCQVSCKDNKDLDVGPKLRRVYEYGGGSWVKEGESWHHDTFTYYLSIACNHCDEPVCVSGCPTGAMHKRKEDGLVVVDDSVCVGCRYCEMRCPYGAPQFDTQANVMRKCDGCLDRLENNLRPICVDSCPQRALDFGPVDELRAKYGTENQIAPLPSASFTHPNLIIKPHPKARPTGDTEGAIMNIREVRHA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,575,789 | -0.87 | 0.25 | ●○○○○ -0.27 | -0.273643863334719 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,575,789 | -0.29 | 0.91 | ○○○○○ 0.02 | 0.0243455326658953 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,575,789 | -0.13 | 0.97 | ○○○○○ 0.11 | 0.111150677328761 | 23637626 |
Retrieved 3 of 3 entries in 1.6 ms
(Link to these results)