Bacterial taxon 909946
Locus STM474_2325
Protein WP_000884778.1
DinI family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 96 aa, Gene n/a, UniProt E8XDS0
>WP_000884778.1|Salmonella enterica Serovar Typhimurium ST4 74|DinI family protein
MLDKPLCGDGLPAIRFLLYRSIPGYFNIDGLPGAKDIILGELTKRVHRIFPDADVRVKPMMTLPAINTDASKHEKEQISRTVQEMFEEAEFWLVSE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,329,441 | -0.59 | 0.43 | ●○○○○ -0.13 | -0.127916804960844 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,329,441 | 0.54 | 0.89 | ○○○○○ 0.46 | 0.459140866377345 | 23637626 |
Retrieved 2 of 2 entries in 1.4 ms
(Link to these results)