Bacterial taxon 909946
Locus STM474_3799
Protein WP_001196509.1
dipeptide ABC transporter ATP-binding protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 327 aa, Gene dppD, UniProt E8XFU4
>WP_001196509.1|Salmonella enterica Serovar Typhimurium ST4 74|dipeptide ABC transporter ATP-binding protein
MALLNVDQLSVHFGDEGTPFKAVDRISYSVKQGEVVGIVGESGSGKSVSSLAIMGLIDYPGRVMAENLLFNGQDLKRISEKERRNLVGAEVAMIFQDPMTSLNPCYTVGFQIMEAIKVHQGGNKKTRRQRAIDLLNQVGIPDPASRLDVYPHQLSGGMSQRVMIAMAIACRPKLLIADEPTTALDVTIQAQIIELLLELQQKENMALVLITHDLALVAEAAHKIIVMYAGQVVETGAAQDIFRAPRHPYTQALLRALPEFAQDKARLASLPGVVPGKYDRPTGCLLNPRCPYATDRCRAEEPALNQLDDGRQSKCHYPLDDAGRPTL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,833,014 | 2.18 | 0.021 | ○○○○○ 1.31 | 1.30824758106506 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,833,014 | -0.72 | 0.68 | ●○○○○ -0.2 | -0.197242821979895 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,833,014 | -0.63 | 0.8 | ●○○○○ -0.15 | -0.151402955054907 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,832,892 | -0.3 | 0.61 | ○○○○○ 0.02 | 0.0213906074875714 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,832,892 | 0.21 | 0.98 | ○○○○○ 0.28 | 0.283645871751995 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,833,471 | 0.21 | 0.99 | ○○○○○ 0.28 | 0.283688837774868 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,833,471 | 0.3 | 0.7 | ○○○○○ 0.34 | 0.335214603698352 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,832,892 | 0.34 | 0.82 | ○○○○○ 0.36 | 0.355586707986569 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,833,471 | 0.79 | 0.59 | ○○○○○ 0.59 | 0.589865075099226 | 23637626 |
Retrieved 9 of 9 entries in 1.4 ms
(Link to these results)