Bacterial taxon 909946
Locus STM474_3801
Protein WP_000938843.1
dipeptide ABC transporter permease DppB
Salmonella enterica Serovar Typhimurium ST4 74
Length 339 aa, Gene dppB, UniProt E8XFU6
>WP_000938843.1|Salmonella enterica Serovar Typhimurium ST4 74|dipeptide ABC transporter permease DppB
MLQFILRRLGLVIPTFIGITLLTFAFVHMIPGDPVMIMAGERGISPERHAQLLAELGLDKPMWQQYLHYIWGVMHGDLGISLKSRIPVWDEFVPRFKATLELGVCAMIFAVAVGIPVGVLAAVKRGSIFDHTAVGLALTGYSMPIFWWGMMLIMLVSVHWNLTPVSGRVSDMVFLDDTNPLTGFMLIDTAIWGEEGNFIDALAHMILPAMVLGTIPLAVIVRMTRSSMLEVLGEDYIRTARAKGLTRMRVIIVHALRNAMLPVVTVIGLQVGTLLAGAILTETIFSWPGLGRWLIDALQRRDYPVVQGGVLLVATMIILVNLLVDLLYGVVNPRIRHKK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,835,211 | 1.49 | 0.044 | ○○○○○ 0.95 | 0.94969633985508 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,835,211 | -0.2 | 0.89 | ○○○○○ 0.07 | 0.0728512835423772 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,835,211 | 0.55 | 0.89 | ○○○○○ 0.46 | 0.461892513597301 | 23637626 |
Retrieved 3 of 3 entries in 0.4 ms
(Link to these results)